Kirkland peanuts discontinued. Kirkland Signature Super Extra-Large .
Kirkland peanuts discontinued It's peanuts and salt, that's it. Jan 27, 2025 · The Kirkland Honey Roasted Peanuts were discontinued despite being a huge hit with happy customers. Published on Mar. 13 kg Kirkland Signature Peanut Butter Filled Pretzel Nuggets, 55 oz Peanut Butter Filled Pretzels; 55 oz. 13KG $22. I would purchase this variety pack again. Consumer Product Safety Commission's Recall website. 5 lbs Virginia VarietyExtra CrunchyGluten FreeKosher Item 222490. They have not had the big block for several weeks and when I asked today, I was told it Kirkland Signature Organic Peanut Butter, 28 oz, 2-count Creamy Dry Roasted Sprinkled with Sea Salt USDA Organic Kosher Item 555000. The Virginia variety peanuts are salted and packed in a resealable tin, ensuring the nuts stay whole during transport and retain their freshness. 29 November 2021 Update - Kirkland Signature Organic Peanut Butter, Made with 100% U. Type and press the down arrow to browse search suggestions. For the Kirkland Signature Mini Peanut Butter Cups, sadly, the company who made them stopped producing the beloved candy for Costco. Contactless delivery and your first delivery or pickup order is free! Start shopping online now with Instacart to get your favorite products on-demand. One acre of peanuts will make 30,000 peanut butter sandwiches. By Kelly Bryant. You'll find a generous ratio of whole almonds as well as cashews and half peanuts. H. . Kirkland peanut butter is natural peanut butter, so there is no sugar. Jul 19, 2021 · Costco has discontinued Kirkland Organic Peanut Butter. 99 Kirkland Signature Organic Cashews Bag, 1. 09 Nov 19, 2011 · Fun facts about peanut butter 1. Why are Costco peanuts so good? While Kirkland’s peanuts may not come directly from the Costco company itself, they are absolutely sourced from some of the best… Read More »Are Kirkland Peanuts Healthy? They weren’t discontinued, they were recalled. But I really like the cheese crisps and ranch flavor of the Parm Crisps variety being discontinued. Same with the Kirkland peanut butter pretzels. Apr 14, 2024 · Kirkland's version, for example, contains a lot of high-quality nuts. It’s official: the Kirkland Signature Semi-Sweet Chocolate Chips have officially been discontinued. Description Kirkland Signature Super XL peanuts are roasted using the unique blister roast process, giving them a superior crunch and texture. If you haven’t heard, Kirkland has “discontinued their brand of organic peanut butter” (we will get to that shortly) and replaced it with Naturally Moore organic peanut butter. 7 out of 5 stars based on For under $9 a pop, Kirkland Signature Organic Creamy Peanut Butter comes in packs of two massive 28-ounce jars and is made with natural Valencia peanuts. Then, to liven it up, there are raisins and two types of M&M's — peanut butter and regular. Get Kirkland Signature Super Extra Large Honey Roasted Peanuts delivered to you <b>in as fast as 1 hour</b> via Instacart or choose curbside or in-store pickup. 28 x 15. This week they're not in stock and two (seemingly disinterested) employees tell me those peanuts are "seasonal". Kirkland Signature Sweet Heat Snack Mix, 24 oz Seasoned and BBQ Flavored Cracker Coated Almonds Seasoned Cashews Honey Roasted Sesame Sticks Seasoned Honey Glazed Pecans Corn Nuggets Item 1732802 Certainly, this Kirkland product looks great in terms of the mix of nuts. Valencia Peanuts is back in some warehouses, your mileage may vary. Nov 12, 2021 · We sure missed our Kirkland PB! They say you don’t know what you have until it’s gone…well that’s the truth! If you’re new to Costco and you’re wondering what the heck I’m so excited about…I guess we’re kinda a HUGE peanut butter family, we eat it daily…and we’ve tried every organic unsweetened peanut butter from Whole Foods, Sprouts, Trader Joe’s plus the major chains FERIDIES Virginia Peanuts Unsalted, Gourmet Extra Large Peanuts Cooked in Peanut Oil, Non-GMO, OU Kosher, 36 Oz CAN Virginia Diner Salted Gourmet Peanuts (36 Ounce 2. One was their large 2+ pound block of mozzarella cheese. The company has released no official reason, but an A good value for 30 packs of healthy, crunchy nuts (10 peanut, 10 cashew, and 10 almond). Anderson collaborated with Costco on its Kirkland Signature Valencia peanut butter-filled pretzels — however, this iteration no longer seems to be available on the Costco website. I'm wondering how Crunch Lovers' Paradise! Kirkland Signature Super Extra Large Peanuts Hit the Spot, Price and Taste On Point! 🥜💥🌟 ⚠️ Attention, non-crunch enthusiasts: These might not be for you! But for those who crave that satisfying crunch with every bite, Kirkland's peanuts are an absolute game-changer. love also foresaw the disappearance of a few products by the brand Filthy. 2 Oz), 59. For over a decade, Costco used to publish and distribute its own handy cookbooks for members on Thanksgiving weekend, but it discontinued the tradition in 2015. Quick & Easy Recipe Videos. Using an old fashion roasting process for our Kirkland Signature Super Extra Large Virginia Variety Peanuts gives them their unique "blistered" appearance and creates an unsurpassed crunch. As Shauna Lopez, buyer for Kirkland Signature Foods, described, "The result was a peanut shortage so severe that Costco couldn't source enough peanuts. Bought this product at Costco and the price was 9. The store has a nice selection of Kirkland brand protein bars, as well as other brands. Nov 6, 2024 · The National Peanut Board reported that due to a peanut shortage in 2011, the product was discontinued in 2012. 13KG Bag $35. The crunchiness was softened by the chewy fruits, which included apples, kiwis, mangos, pineapple, papaya, strawberries, cherries, raisins, and banana chips. 7 Costco Kirkland Products That Disappeared but Shoppers Want Back - NewsBreak Apr 19, 2024 · The Kirkland Signature organic creamy peanut butter came in a pack of two 28-ounce containers. Costco. The warehouse’s tin of Kirkland Virginia Peanuts is a robust 40 ounces, and costs only $8. Unfortunately, there's not quite enough of the sweet stuff to balance out the nuts. "No idea why they discontinued it, but according to the guy who actually called me from my local Costco, it was a corporate decision. Sep 8, 2024 · It's unclear, yet again, why Costco stopped selling its Kirkland Signature turkey burgers, but they were discontinued in 2018. Dec 2, 2024 · Here are some of the most noticeably missing and deeply missed discontinued products to ever once grace a Costco warehouse that are pretty unlikely to ever make a comeback, based on our research. After switching to natural peanut butter, I find Jif and the rest to be gross, despite growing up eating Jif. Membership Information. All three varieties tasted great and arrived fresh/in good condition. Kirkland Signature Super Extra-Large Aug 20, 2012 · None of the Costco warehouses in Tucson carry the Kirkland brand peanut butter anymore. This bag of frozen turkey burgers could be found in the frozen aisle. Costco stopped selling the product in early 2021, but it returned by November of that year. Disclaimer: This Subreddit is not affiliated with… Nov 17, 2022 · And for under $9 a pop, Kirkland Signature Organic Creamy Peanut Butter comes in packs of two massive 28-ounce jars (via CostContessa). 4x Kirkland Signature Macadamia Clusters - 32 Oz. May 17, 2023 · Costco's Kirkland peanut butter cups have been fiercely missed Credit: Kirkland. 57 x 8. The Costco Connection. Why was the one I received from Amazon 2 1/2 times more expensive ? Jul 27, 2021 · "I normally buy a two pack every other week but it's been gone for a month now. it isn't surprising that Costco discontinued the Kirkland Welcome to r/QuikTrip! This is the place where you can connect with other fans of QuikTrip, the convenience store that has it all! Whether you’re looking for a quick snack, a refreshing drink, a friendly service, or a fun NFT, you’ll find it at QuikTrip. 29 1 How to get it closeout, and discontinued items. 5 Pounds Amazon. "I wrote a letter to Costco about this, and they forwarded it to the provider that had made these," wrote one fan of the peanut butter cups on For the things I normally shop for and use to buy regularly atCostco, many items have been permanently discontinued or the quality has drastically changed so I’ll no longer purchase the item. Apr 24, 2023 · Costco is a great place to buy protein bars. Wonderful news: I had found a few articles about the best natural peanut butter, and some of the brands mentioned had the same two ingredients as my beloved Kirkland brand peanut butter. Variety includes: Salted Peanuts, Salted Cashews, Honey Roasted Peanuts; Kirkland Signature Super Extra-Large Peanuts, 2. contains: peanuts, wheat. Mar 25, 2025 · Costco Just Discontinued Another Beloved Kirkland Product—And Fans Are Outraged. After a quick disappearing act in the fall, Costco recently brought back its ever-popular Kirkland Signature peanut butter pretzel nuggets. Here are seven that shoppers desperately want back. And for all things peanuts and nut-buttery, from the most delicious American peanut butter on a piece of white bread to savory Malian meat stew with a garnish of peanuts eaten out of a wooden bowl, and not excluding all of the alternatives for our allergic bretheren. 25 Pound Pack of 1) Virginia Nuts Blister Roasted for Perfect Crunch, All Natural Ingredients, Heart Healthy Snack, Virginia Peanuts Lightly Salted Dec 13, 2023 · I have previously reviewed both nuts (Product Review: Kirkland Signature Extra Fancy Unsalted Mixed Nuts) and nut butters ((Product Review:Kirkland organic creamy peanut butter); Product Review: Kirkland almond butter)). And the per-ounce price can’t be beat. Confirmed. 4. ingredients: enriched wheat flour (wheat flour, niacin, reduced iron, thiamin mononitrate,riboflavin, folic acid), peanut butter (roasted peanuts, sugar, salt), salt, contains less than 2% of high oleic canola and/or soybean oil, corn syrup, barley malt extract. 2-Day Delivery. " This was in response to a topic started by another Reddit user with the tragic heading, "Say it ain't so! Kirkland peanut butter discontinued!" Apparently, the beloved 28-ounce two packs were completely gone from store shelves when they went looking for it recently. We've taken our process back to the beginning, using an old fashioned roasting process called "blister roast". 25, 2025. The change took effect because of an increased demand for paper towels amid the ongoing pandemic, and Costco says it's only temporary. Kirkland Signature Mixed Nut Butter with Seeds, 27 oz Item 1290439. Back in September, Costco shoppers began reporting that the fan-favorite Kirkland Signature Peanut Butter Filled Pretzel Nuggets hadn't been available for purchase for several weeks. 49 cm; 1. Their solution to declining Almond sales…add peanut oil and change the packaging!! Good luck with that. Al Kirkland Peanuts Roasted and Salted Extra Crunchy, 1. Membership. 2 Ounce (Pack of 1) : Grocery & Gourmet Food Costco recently decided to stop selling Kirkland brand Dry Roasted Salted Almonds because of a decline in sales over the last 5 years. i am not a fan of peanuts, so this combo is perfect Kirkland Signature Sweet Heat Snack Mix, 24 oz (1 Lb 8 oz) 680g Spicy Snacks with Peanuts, Pretzels, Sesame Sticks, Toasted Corn, Cashews, Inspired by Hot Ones Apr 14, 2023 · The chain of big-box stores has announced a recall of their SimplyProtein Peanut Butter Chocolate Crispy Bars due to an undeclared trace of cashews, which could be dangerous for anyone with tree nut allergies. Nutrition Facts. Reply Nov 6, 2022 · Peanuts are a good snack choice! They are filled with protein, fiber, vitamins and minerals – just the things your body needs to keep feeling full and energetic. Dec 5, 2023 · Well, as the adage goes, good things come to those who wait. Costco's bakery offers a mix of products that come and go along with customer favorites that stand the test of time. Plastic Jar; Packed In The USA; Rated 4. Peanuts are a new world food, probably originating in Brazil and working their way up to Kirkland Signature Butter Toffee Cashews, 24 oz Product details Product Dimensions : 1. This stellar snack was jam-packed with crunchy nuts like peanuts, almonds, and walnuts. Employee Site. Kirkland Signature Organic Animal Crackers, 4 lbs Tasty snack, great for lunches and parties Can use as a topping for yogurt or frozen treats Try post-workout in a peanut butter sandwich Item 772756 Sadly, those entered the great abyss of discontinued Costco items in 2018. The warehouse manager says that rising cocoa prices mean Aug 14, 2024 · On July 31, a Reddit user shared some intel on a product favored by both Costco-lovers and chocolate chip cookie-makers: Kirkland Signature chocolate chips had been replaced at their local store. Americans consume 700 million pounds of peanut butter annually, about three pounds per person! 2. 84 inches; 1. On Feb 24, 2025 · With two 28-ounce jars retailing at about $14, Kirkland Signature Organic Peanut Butter is a steal for anyone looking to stock up on organic peanut butter. I thought this one I just received was a lot bigger for the price I paid . 677 votes, 145 comments. Costco Blog. "Got two just in case," they wrote. The thin layer of dipped chocolate is light and, again, not overly sweet, but it provides an additional flavor that is much appreciated. It's been replaced by an organic, creamy, unsweetened peanut butter from Naturally More. The Kirkland Signature Milk Chocolate Peanut Butter Cups were absolutely divine. Nov 19, 2023 · While Virginia peanuts can be a bit pricier than some more common types of peanuts, I think these are worth every penny. Kirkland Costco has discontinued many beloved Kirkland Signature products over the years. Share Share Print Kirkland Mixed Nut Butter is an amazing alternative to peanut butter Peanuts can fuck right off with their oily selves. The company specializes in all things cocktails from drink mixes and starter kits to syrups and garnishes. 9 x 13. com: KIRKLAND SIGNATURE Chewy Protein bar Peanut Butter & Semisweet Chocolate Chip (42 X 1. Coincidentally these peanut butter have the same nutritional content, look, and taste the same, and are both made from high-quality Valencia peanuts, and no one at Type and press the down arrow to browse search suggestions. Reply reply Ok-Bag-0 • Kirkland Signature Organic Animal Crackers, 4 lbs Kosher USDA Certified Organic 64 oz Container Packed In The USA Jun 1, 2024 · With such a vociferous outcall for the return of the Fruit & Nut Medley, one wonders why Costco ever did away with it in the first place. - (8 Lbs. Today, I went to my nearby Costco to buy several items I usually get there. In the few years since the Kirkland Signature peanut butter cups have been gone, Costco has brought in other products Get a $100-$200 Costco Shop Card with the Purchase of Select Mattresses. com (833) 765-2846 Mon-Fri 9AM-5PM PST The last time I saw the Kirkland Honey Roasted Peanuts was in 2019. 🚀 May 1, 2016 · Kirkland organic animal crackers contains wheat and soy. hello@snackathonfoods. Kirkland Signature Mixed Nut Butter with Seeds, 27 oz. Most of the sweetness will come from the sugar coating of the peanuts. Our Costco carts will never look the same Aug 24, 2024 · Costco Discontinues Kirkland Brand Chocolate Chips . 99 for the Kirkland 4 pound animal crackers . Kirkland Signature. 18. With just a touch of salt added, there's nothing to interfere with the natural peanut flavor. For additional information visit the U. As it turned out both were Kirkland animal crackers in a 4 pound container . Jan 12, 2021 · The entire ingredients-list on this product is at least okay except for people who have allergies to almonds, coconut, milk, peanuts, or soy. According to this post from two years ago, it has been discontinued by corporate decision. 41 Oz) Total Net Wt (59. Mar 17, 2023 · 30. On Saturday, December 2, one neighborly Redditor shared a photo of several tubs of the Kirkland Signature peanut butter pretzels in stock at their local Costco in Colorado. 27 x 9. Sep 16, 2023 · The discontinued food court sandwich isn't the only turkey product that shoppers miss. It's not half bad either — some Costco loyalists swear by it, refusing to eat anything else. BUT if you are a Costco member, get ready for a treat and a bargain. Join Now. Orders & Returns. However, although I very much enjoyed the Kirkland Signature Super Extra-Large Peanuts, I had neglected to review them Dec 4, 2023 · Costo fans, rejoice! Months after one of the retailer's most popular snacks mysteriously disappeared from shelves, the item is finally making a return to warehouses. Kirkland Signature Severe Cold & Flu - Specific Code - Select Locations in the MidWest and South East (Item #1729556) For non-food recalls older than 120 days, please visit our archives page . Nov 6, 2022 · Simply put, raw peanuts are air-dried peanuts that hold the appropriate moisture content for storage—the ideal moisture content hovers around 10%. Item 1290439. The 4 nuts in the ingredients have some of the lowest carb content that I know of: pecans, hazel nuts, Brazil nuts, and macadamias. K. Kirkland Signature Milk Chocolate Peanut Butter Cups. I enjoy making pizzas, and use a lot of mozzarella and other cheeses. Welcome to Costco, we love you. On Amazon a 32-ounce tin from another brand sells for $23. It's been a few years since they have disappeared from Costco shelves – apparently because the manufacturer (Linnette) stopped producing them for Costco – and we are still sad about it! Is discontinued by manufacturer : No Package Dimensions : 32. One Redditor hoped to get Costco on the horn about bringing back the Trek Mix, commiserating with others , "The Kirkland brand Trek Mix was fantastic Get Kirkland Signature Super Extra-Large Peanuts, 2. 13kg $29. Utz / Costco. The loss of the candy has been felt hard by shoppers across the country, and some even reached out to the company in hopes of changing the situation. The warehouse’s tin of Kirkland Virginia Peanuts is a robust 40 ounces, and costs only $6. These crackers have a serving size of 28 grams (about 11 animal crackers). Roasting our Kirkland Signature Super Extra Large Virginia Variety Peanuts in this way gives them their unique "blistered" appearance and creates an unsurpassed crunch. 3. Add in the fact that it's made with Valencia peanuts — the plant of choice for all-natural spreads, according to the National Peanut Board – and it isn't surprising that health-conscious shoppers with a Dec 2, 2024 · 9. The early February post from @costco. I HOPE that it WON’T be discontinued. Nor (in my opinion), can the taste. Oct 21, 2022 · thank you for posting about this nut butter from kirkland! it was discontinued last year to my horror as i am addicted to it and spoon it right out of the jar onto my brunch banana every day. 69 Kirkland Signature Extra Fancy Mixed Nuts 1. PCA owner Stewart Parnell was later found guilty of fraud and sentenced to prison for intentionally allowing dangerous tainted food to enter stores like Costco. Other brands tend to add an oil and a Kirkland Signature Super XL peanuts are roasted using the unique blister roast process, giving them a superior crunch and texture. Check out Kirkland praline pecans, Kirkland honey roasted macadamia, and Savanna Orchards honey nut mix. i cannot duplicate this, which is what i try to do whenever i can, because for the price ~ impossible. Logo and Media Requests. 99. All prices listed are delivered prices from Costco Business Center. Oct 16, 2024 · If you're a long-time Costco member, you may remember the Kirkland Signature Fruit & Nut Medley. Both the red bag and the blue bag (with 51% cocoa) are being replaced with Nestlé Toll House products, and fans aren’t taking the news well. Jun 14, 2024 · This Kirkland item, weighing in at 3 pounds, featured an array of peanuts, walnuts, almonds, apples, kiwis, pineapples, and more. Ever. 626K subscribers in the Costco community. However, if you go there in search of Kirkland Cinnamon Roll Protein Bars, you won't find what you're looking for. Costco-branded cookbooks. Oct 12, 2024 · A small ¼-cup serving packed 150 calories, but for serious snackers, the flavor easily crushed other mixes like the now-available Kirkland Signature trail mix with boring peanuts and M-(meh)-M's. Allergen information: The product is processed on equipment that also packages other products. Costco's turkey burger patties weighed in at ⅓ of a pound and had just 200 calories per burger. The discontinued 7 layer burrito Type and press the down arrow to browse search suggestions. Anderson peanut butter-filled pretzel nuggets. But today, I found this site that apparently have them in stock. One item in the latter category that customers found to be discontinued in 2024 was the Kirkland Signature Country French Bread. 69. I'm good for 2 years lol. I love those so much I kept the empty container in hope that I'll find them again in stock someday. Price changes, if any, will be reflected on your order confirmation. Product availability and pricing are subject to change without notice. I love, love, love the WF 365 peanut butter in both creamy and chunky because it's a bit textured or even gritty (mmm little pieces of tiny peanut). Once this order is placed, there are no Snackathon Foods. Jun 12, 2021 · Kirkland Premium Towel rolls used to come with 160 sheets, but now they come with 140. Dec 11, 2023 · Costco’s Kirkland Signature Peanut Butter Pretzel Nuggets Are Back . This much peanut butter would take a while to consume, so it definitely requires some commitment on Kirkland Signature Butter Toffee Cashews, 24 oz A true butter toffee flavor No Artificial Flavors or Colors Kosher 24 oz Resealable Pouch Produced in the USA Mar 4, 2020 · Great Product but appears to have been discontinued at Costco. 4429 95th St SW Bldg 8B Suite E Lakewood, WA 98499. They were always available online for more $$ but it was worth it to me. November 2021 Update - Kirkland Signature Organic Peanut Butter, Made with 100% U. That's because Kirkland stopped offering the cinnamon roll flavor back in 2018. Why did they discontinue the honey peanuts? May 14, 2023 · There are many reasons why a product can be discontinued at a store. If there’s one sweet Costco shoppers loved to stock up on at the store, it was the Kirkland Mini Peanut Butter Cups. I would give this product five stars out of five. Cart Kirkland Super Extra-large Peanuts are seasonal? I've been buying these peanuts about every 3 or 4 weeks the last few years. See our review! If you're not completely satisfied with this Kirkland Signature product, your money will be refunded. Kirkland Signature Super Extra-Large Peanuts, 2. S. " Kirkland Signature Dry Roasted Almonds 1. Under its Kirkland Signature private label brand, Costco sells big boxes of Protein Bars. Please call your local warehouse and ask about item number 555000 for status or arrival information accurate to your specific warehouse. A subreddit for peanut butter, in all its evolution disproving awesomeness. Raw peanuts are considered a produce and to maintain the best quality, raw peanuts are stored in a cool, dry place. 6 oz $1. Costco used to carry 12-count bags of Kirkland Signature Turkey Burgers, which were made with premium, extra-lean, all-natural turkey. 5 lbs Item 222490 Aug 8, 2024 · One Costco shopper even bragged about scoring some of the last Kirkland ones, writing, "Scored 3 bags of Kirkland brand a few weeks before they switched to evil Nestle. ) Mauna Loa Premium Hawaiian Roasted Macadamia Nuts, Milk Chocolate Flavor, 10 Oz Bag (Pack of 1) Macadamia Nuts | MacFarms Dry Roasted Macadamia Nuts 24 OZ (1 Pack) - Premium Roasted Nuts with Sea Salt Fresh From Hawaii, Sea Salt Flavored Healthy Snack The semi-sweet chocolate chips are just that; they aren’t absurdly sweet or overpowering by any means, but a great mix-up to the peanuts. Oct 12, 2011 · Just a note--if you're at all sensitive to texture in your peanut butter, I don't think the Whole Foods 365 brand peanut butter will be a good substitute for the Kirkland Signature brand. I think it is by far the best natural or organic peanut butter on the market. Cart For years I have been buying their Kirkland Organic Peanut Butter and my kids eat PB&J sandwiches for lunch on almost a daily basis. 5 lb delivered to you <b>in as fast as 1 hour</b> via Instacart or choose curbside or in-store pickup. SOPA IMAGES/GETTY IMAGES. Aug 14, 2024 · On July 31, a Reddit user shared some intel on a product favored by both Costco-lovers and chocolate chip cookie-makers: Kirkland Signature chocolate chips had been replaced at their local store. Ingredients: Peanuts, coconut oil, salt. It has been discontinued. Some items are just too expensive now to buy and I do without. Mar 24, 2023 · Amazon. Peanuts are technically legumes (like beans), not nuts. Aug 16, 2024 · According to the statement, Costco promises that its Kirkland Signature products offer equal or better value compared to national brands. These products may contain milk, eggs, wheat, soy, peanuts, and tree nuts. We love the taste and mommy loves that there are only two ingredients: peanuts and salt. Cart Oct 23, 2024 · An estimated 710 people in 46 states got sick on salmonella from peanuts and peanut butter, and eight people died. Enjoy some today and give new life to an old tradition! Dec 22, 2024 · Costco. Posted by u/SupremeGunman - 2 votes and 1 comment Oct 27, 2022 · Kirkland Signature Organic Large Brown Eggs and Kirkland Signature Liquid Egg Whites are among the available cage-free Costco products. sweiruyxfsmzfdqnishxuxewpwmprtdqmvlrsgylqemmwpwsdpqgcqlhjyiekbrxcdqze